Module 7.

Multiple sequence alignments and sequence editors

This module deals with multiple sequence alignments, how to make them and how to edit them. So far in the course, we have used sequence alignments that were already made by someone else. You have learned how to find sequences that are similar to query sequences by BLAST searching. The next step in analyzing these new sequences is to add them to an alignment and calculate phylogenetic trees to see the relationships between the sequences. Making a multiple sequence alignment can be done by hand, but it is a slow tedious process. It can also be done by programs, but the results may need some adjusting, since the programs are not perfect.

Before we talk about multiple sequence alignments it is necessary to cover a little history of how optimal alignments of two sequences are made. There are two different approaches to making sequence alignments. One method maximizes the similarity between two sequences. This is the Needleman-Wunch algorithm (1970). A different approach minimizes the differences between two sequences. This is called the Smith-Waterman algorithm (1981). These two algorithms look very different in how they proceed, but they have been proven mathematically to be identical.

The Needleman-Wunch algorithm creates an array with the two sequences on the edges of the array. Each cell in the array represents the comparison of two amino acids, one from each protein. These are given a score based on a similarity matrix like the PAM or BLOSUM matrices. The scores in the array are added together following some simple rules and then the path through the array that has the highest scores is identified. This represents the optimum alignment of the two sequences. This operation is dependent on N x M operations where N and M are the lengths of the two sequences. You can see that this will be memory intensive for average sequences of say 500 amino acids, an array of 250,000 elements is needed. The algorithm can be done in n dimensions where n is the number of sequences, but the array sizes keeps growing as a multiple of the sequence lengths. In reality even three 500 amino acid sequences becomes impossible (array size 125 million).

Because these rigorous methods cannot be extended to more than two sequences, multiple sequence alignment was done by hand up until about 1987. At that point several people began to ask how can we simplify this problem so it is not so big? The answer is called progressive alignment. In progressive alignment, all the sequences are compared against one another to get a score of relatedness. The matrix of these scores (usually the difference between sequences) is called a difference matrix and this is used to make a tree called a guide tree. In the guide tree the most similar sequences are clustered together. This guide tree is the basis for the multiple sequence alignment. The most similar sequences are aligned one at a time to each other. As sets of aligned sequences are built up, the most similar sets are aligned with each other, until the last sequence is added. At each step, the computational cost is like alignment of only two sequences rather than N sequences. It is possible to do this with large numbers of sequences even on a desktop computer.

The result is not a perfect alignment. The errors that occur early will be propogated throughout the alignment as more sequences are added. To keep the computational cost low, once a gap is added, it cannot be removed. You may imagine that large errors are possible if the two sequences being compared are not of similar length. The progam will have to add gaps and the placement of the gaps can be critical for later steps in the alignment process.

ClustalW

The most popular program for making multiple sequence alignments is ClustalW. This is a newer version of ClustalV. There is also an even newer X-windows version called ClustalX and this can be downloaded and installed on a desktop computer from this ClustalX Link. A tutorial on the ClustalX software is available from those wonderful folks at Molecular Systematics and Evolution of Microorganisms. The Natural History Museum, London and Instituto Oswaldo Cruz, FIOCRUZ Rio de Janeiro, Brazil. Click here ClustalW is available at several servers at different web locations. Some of these limit the number of characters you can submit to be aligned and these are not very useful. We have two ClustalW servers on both of our LINUX servers and they can be used for the course.

ClustalW server here

or the Alternate ClustalW server here

ClustalW server at EBI

ClustalW server at EBI with JalView sequence editor

ClustalW server in Japan

The ClustalW servers have requirements about sequence input format. They can read multiple formats [FASTA (Pearson), NBRF/PIR, EMBL/Swiss Prot, GDE, CLUSTAL, and GCG/MSF]. The simplest to use and one we have already got in our mitochondrial carrier files is FASTA format. Each sequence has the first line starting with a > and identifier information. The sequence follows. Additional sequences are in the same format. I have run 51 human carriers through this server and it works fine. I would not recommend doing so many during class since the server will get overloaded.

Considerations when making ClustalW alignments.

The human carriers we worked on have some carriers with N-terminal extensions (50, 52, 55, 89, 91, 132. and 134). Some had C-terminal extensions (89, 91). These are not useful for making a multiple sequence alignment and they should be trimmed to cut off the extended parts. If you do not, the alignment will be several pages longer and this is a waste of computer time and printer paper.

How to do a multiple sequence alignment

Go to this link. Trimmed human carriers

Select about 5-10 sequences (not all starting at the first sequence) and copy and paste them into our ClustalW server. Click on the protein button. Let the first row go first and when they have results let the second row go etc. so we do not overload the server. You should get a result like this:


26              -------------------MGDHAWSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHA 41
30              -------------------MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHA 41
33              -------------------MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHA 41
44              MIQNSRPSLLQPQDVGDTVETLMLHPVIKAFLCGSISGTCSTLLFQPLDLLKTRLQTLQP 60
                                         .. * **.*.::.: *.  . *:: :*  **. :.

26              SKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQLFLG 101
30              SKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLG 101
33              SKQITADKQYKGIIDCVVRIPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLG 101
44              SDHGSRRVGMLAVLLKVVRTES---LLGLWKGMSPSIVRCVPGVGIYFGTLYSLKQYFLR 117
                *.: :      .::  :**  .   .*.:*:*  ..::* .*  .: *.   . ** ** 

26              GVDRHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGAAQREFHGLGDCI 161
30              GVDKHTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGTEREFRGLGDCL 161
33              GVDKRTQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKSGAEREFRGLGDCL 161
44              GHPPTALESVMLG-----VGSRSVAGVCMS-PITVIKTRYESGK-----Y-GYESIYAAL 165
                *          :.      *: ..:.:*:  *: . :**  :.         :..:  .:

26              IKIFKSDGLRGLYQGFNVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIFVSWMIAQS-- 219
30              VKITKSDGIRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQT-- 219
33              VKIYKSDGIKGLYQGFNVSVQGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQT-- 219
44              RSIYHSEGHRGLFSGLTATLLRDAPFSGIYLMFYNQTKNIVPHDQVDATLIPITNFSCGI 225
                 .* :*:* :**:.*:..::     : . *: .*: :*.::*. :    .:.    .   

26              -VTAVAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNV 278
30              -VTAVAGVVSYPFDTVRRRMMMQSGRKGADIMYTGTVDCWRKIFRDEGGKAFFKGAWSNV 278
33              -VTAVAGLTSYPFDTVRRRMMMQSGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNV 278
44              FAGILASLVTQPADVIKTHMQLYP------LKFQWVGQAVTLIFKDYGLRGFFQGGIPRA 279
                 .  :*.:.: * *.:: :* : .      : :  . :.   * :* * :.**:*. ...

26              LR-GMGGAFVLVLYDEIKKYV---- 298
30              LR-GMGGAFVLVLYDELKKVI---- 298
33              LR-GMGGAFVLVLYDEIKKYT---- 298
44              LRRTLMAAMAWTVYEEMMAKMGLKS 304
                **  : .*:. .:*:*:
There are parameters that you can set and we need to talk about them. The two types of alignment that the program does are pairwaise alignment of two sequences and multiple alignment of two blocks of aligned sequences with each other or a single sequence with a block of aligned sequences. These have separate parameters. The values that you may want to change are the gap opening penalty and the gap extension penalty. The default values have been chosen by trial and error to be pretty good values, but if your alignment has some odd gaps in it or sequences are not lining up as you think they should then do not hesitate to change these values. Higher gap penalies will make gaps less frequent and higher extension penalties will make gaps shorter. The other option you have that can make a significant difference is the matrix used to score the proteins. This can be BLOSUM or PAM or two others. The ID matrix only scores identities, so this is a very simple matrix. In my use of this server, I find PAM to be better than BLOSUM at the mito carrier alignments.

The alignment output that we got was clustal. This can be set to other formats depending on what you want to do with it. Later, we will be using the alignments to make trees using Phylip, so then you will want to select the Phylip output option. Do a ClustalW alignment on any 4 carrier sequences and request the output as PHYLIP format for later use. When the result comes back select the text from the number line (one line above the sequence alignment) through to the end of the sequence alignment. Paste this in Word, name it Carrier1 and save as text only on the desktop. Later we will have to drag it into the SeaView folder so that program can see it.

Evaluating the alignment results

Alignments can tell you several things. If you have made a mistake in assembling a gene, it will often turn up in the alignment. I show one example below.

89              LPYNLAELQRQQSPG-LGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTR-MQNQ 357
91              LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTR-MQNQ 359
94              ----------------------------------GGIAGLIGVTCVFPIDLAKTR-LQNQ 39
95              ----------------------------------GGVAGLVGVTCVFPIDLAKIR-LQN- 38
132             ------------------------------HMTAGAMAGILEHSVMYPVDSVKTR-MQSL 76
134             ------------------------------HMVAGAVAGILEHCVMYPIDCVKQTRMQSL 61
In this example, the bottom sequence is too long by one amino acid. The sequence lines up very well except for the Q in VKQTR. This is the end of an intron (CAG) that was not removed in assembling this gene. Below is another section of the carrier alignment.


106             RPSMASELMPSSRLWSLSYTKLPSSLQSTGKCLLYCNGVLEPYLCPNGARCATWFQDPTR 102
106A            RP-----------------------SMASGKCLLYCNGVLEPYLCPNGARCATWFQDPTR 79
106B            RPSMASELMPSSRLWS--------LSYTKWKCLLYCNGVLEPYLCPNGARCATWFQDPTR 94
In this example, there is alternative splicing. The three sequences are identical except in this region. The gaps are missplaced, since the SMAS should pull back to the other side of the gap on sequence 106A and the LSYTK should also pull back on sequence 106B. This is something that might be fixed by choosing different matrices for scoring. Changing gap penalties will not affect this because the gap lengths will stay the same. It is interesting to note that this error does not occur in the EBI ClustalW server. It would be interesting to compare the settings.


55              -MLEGS-PQLNMVG---LFRRIISKEG--IPGLYRGITPNFMKVLPAVGIS-----YVVY 465
57              -VLPEF-EKCLTMRDT-MKYDYGHHGI--RKGLYRGLSLNYIRCIPSQAVA-----FTTY 322
62              -VTGYP-RASIAR--T-LRTIVREEGA--VRGLYKGLSMNWVKGPIAVGIS-----FTTF 295
165             -GSSAS-LVLKRLGFKGVWKGLFARII--MIGTLTALQWFIYDSVKVYFRLPRPPPPEMP 350
167             -GSSAS-LVLKRLGFKGVWKGLFARII--MIGTLTALQWFIYDSVKVYFRLPRPPPPEMP 351


55 ENMKQTLGVTQK------------------------------------------------ 477 57 ELMKQFFHLN-------------------------------------------------- 332 62 DLMQILLRHLQS------------------------------------------------ 307 165 ESLKKKLGLTQ------------------------------------------------- 361 167 ESLKKKLGLTQ------------------------------------------------- 362
In this example, sequence 165 and 167 do not line up with conserved parts of the other sequences. The alignment is fine between the two sequences 165 and 167, so the parameters for pairwise alignments are good. By increasing the gap penalty for multiple alignments to 12 this misalignment was not corrected, but changing to the PAM matrix and gap penalty of 12 did fix this problem in the alignment. (see below)

55              MLEGSP-----QLNMVG--LFRRIISKEGIPGLYRGITPNFMKVLPAVGISYVVY 465
57              VLPEFE-----KCLTMRDTMKYDYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTY 322
62              VTGYPR-----ASIAR--TLRTIVREEGAVRGLYKGLSMNWVKGPIAVGISFTTF 295
165             ----------------KGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIY 332
167             ----------------KGSSASLVLKRLGFKGVWKGLFARIIMIGTLTALQWFIY 331


55 ENMKQTLGVTQK------------------------------------------------ 477 57 ELMKQFFHLN-------------------------------------------------- 332 62 DLMQILLRHLQS------------------------------------------------ 307 165 DSVKVYFRLPRPPPPEMPESLKKKLGLTQ------------------------------- 361 167 DSVKVYFRLPRPPPPEMPESLKKKLGLTQ------------------------------- 362
The parameters for the alignment will never be absolutely right for all regions of a complex alignment. That is why you need to look at the alignment and make adjustments to it based on your ability to see things that the program just does not know about. For example, there may be certain motifs or signature sequences that you know are present in every member of a protein family. If these motifs are not very strongly conserved in their sequence an alignment program can easily fail to line them up. This is what happened in the sequences shown above. As the expert, it is your task to take an alignment given by ClustalW and improve it by your expert knowledge. This requires either working with the sequences in a word processor or a special type of program called a sequence editor. The word processor can be used, but it has some limitations. If the sequences are longer than 70 amino acids or nucleotides, then the sequence must be represented as multiple pages. This can be a real irritation if you have to add gaps into the alignment, because the position of all the sequence after the new gaps has to be shifted even if that is over 10 pages of an alignment. Sequence editors are built to keep the sequence in an array and display only one section of it at a time. Addition of gaps is not a problem because the array is just made longer. Also the sequence editor can color code the amino acids in any way you define, This can help identify sections of a sequence that are out of alignment with the other sequences around it. The main problem with sequence editors is they are very very particular about the sequence format of the files you ask them to read. If they ask for Phylip format and even one character is not in that format the file will not be read. This can lead to great frustration. In Phylip format, even a blank space following a line of sequence can throw the program off. It tries to count the blank space as a character and either crashes or tells you the sequences are out of alignment. To avoid this problem, alignments to be read into the programs need to be edited in a word processor to remove all offending blanks at the ends of lines. This is done easily in Word by using the paragraph mark button on the top right side of the tool bar. This reveals were the line returns are placed and shows any blanks at the ends of lines.

Because sequence editors are so graphical, they are usually not written to run on both Macs and PCs. Depending on which system you have you may need to download different programs. The editor we will use on these Windows machines is called SeaView. It was written by Manolo Gouy and it can be downloaded from this link. A gif image of what the editing screen looks like is shown here

The image shows a section of an alignment of Fugu and human P450s. At amino acids 9-11 is the highly conserved EXXR motif seen in the K-helix of all P450s. If you scroll down the page you will see one exception to this motif. T2TP contains EIQC which violates the EXXR conservation. However this is a pseudogene and it is not functional. Far to the right if you scroll over all the way you will find the heme signature region of P450s. The first sequence has FSAGKRICVG. The signature is FXXGXXXCXG. Notice that the F is missing in one sequence. That is probably an error in this sequence. Another sequence editor written for Macs is called Se-Al. This one was written by Andrew Rambaut at the Dept. of Zoology at Oxford with support from The Wellcome Trust. It can be downloaded here.

Now start the SeaView sequence editor. The program has a few example files in it. Under the file menu select open MASE. This gives a list of files. Click on Protein.mas. This is a protein alignment file in MASE format. MASE is mentioned by the authors as having lots of room for long names and other descriptive information such as accession numbers, species names etc. This is not included in formats like Phylip where there are only 10 spaces reserved for a name. The authors really like the MASE format for that reason. However, because we will be using Phylip later, we will use Phylip format in this class.

Scroll down using the left side scroll bar and scroll right using the bottom scroll bar. You can see the alignment in full glory. Notice that the names stay on the left as you scroll to the right, so you can always tell what sequences you are looking at. Across the top on the left and right are position counters. These count the alignment position of the left and right edges of the window. These are not amino acid numbers, since the alignment has gaps in it. To get the amino acid number for any amino acid just click on it. The number will be displayed in the same bar as the counters and it will look like this

Seq:26 pos: 126|113 [CYP21 human]

This tells the sequence number, the position in the alignment and the amino acid number from the first position in the alignment (skips counting the dashes) then the name is given in brackets.

To select a sequence click on the name. To select more than one sequence click and drag. To select non-adjacent sequences just click on each one. A second click will deselect the sequence. If you want to clear all your selections to start over, double click on any name. It is often necessary to move sequences in an alignment to put them next to one another for comparison. To move a sequence in SeaView, select the sequence by clicking on it. Move your cursor to the location where you want it to go and control click (hold down the control key and click). This will move your selected sequence to the new location. If you want to move a block of sequences select the block by dragging and do the same thing.

This is a sequence editor, so how do you edit the sequences. Place your cursor at the point where you want to change the sequence. You can add dashes or delete dashes to slide the sequences. If you want to add or delete gaps to a set of sequences or even all the sequences, select the sequences as above and then add gaps to one of them. Gaps will be added to all the selected sequences at the same time. To add or remove amino acids you must go to the PROPS menu and check allow seq. edition. If you do not do this you cannot change any of the amino acids. Also under the PROPS menu you can allow lower case. I often use lower case to be sequence from a different species that I am using temporarily to fill in a sequence gap. For example, if I have found a Fugu P450 and it is missing the last 20 amino acids, but I have that sequence from medaka (Japanese rice fish), then I can add the medaka sequence in lower case to fill in the missing sequence until I can find it later.

The edit pull down menu allows you to delete a whole sequence by first selecting it and then choosing the delete command from the edit menu. From this same menu you may delete all columns that contain only gaps. This often happens when you remove sequences or trim sequence ends. There is also a consensus option button that builds a consensus sequence from selected sequences. The dot plot option can let you know if your sequence is in correct alignment with another sequence. If the two sequences are out of alignment the diagonal between the two will not fall on the strict diagonal (in red). This indicates one sequence is shifted relative to the other sequence. You can see this by adding a moderate gap into one sequence and then comparing it to its neighbor in a dot plot.

The color scheme can be altered from the PROPS menu under colors. The default for a protein alignment is protein colors, but there is also inverted colors. This makes the backgound colored and the letters are black. This forms vertical bars of solid color when sequences are conserved. There is a way to make your own color scheme with up to 10 colors. You can write a short one line text file called seaview.ini that has to be placed in the seaview folder. This file will say

altcolorgroups = KR,ILMV,AGST,ED,FYW,QNBZ,H,C,P

The color order is fixed and is as follows: red, green, yellow, blue, cyan, magenta, salmon, purple, aquamarine, dark-gray (white is used for dashes). In this example, KR will be red, ILMV will be green, AGST will be yellow, etc. If this file is in the seaview folder when the program is started it will allow you to select alt colors from the PROPS color menu. In this scheme, the positive charges are red, the negative charges are blue, the aromatics are cyan, the aliphatic hydrophobics are green. You can imagine other color schemes that emphasize different properties of the amino acids. If you wanted to color all the charges red and everything else green, use

altcolorgroups = KRED,ILMVAGSTFYWQNBZHCP


Once you have altered the file you can save it and you can print it. Before printing, you have to prepare a printout from the FILE menu. This dialog box requests a name for the printout and it lets you select some options, such as how many lines per page and how many amino acids per block and characters per page. Once the printout is saved you can open it in Word and print it. This program does not let you print out the color alignment. For that type of job you need another program such as PRETTY or BOXSHADE.

Now that we know the basics, lets try to get a sequence alignment into this program to view it. You have just made several CLUSTALW alignments and saved at least one called carrier1 in PHYLIP format. Drag this file from the desktop to the Seaview folder. Try to open carrier1 from the SeaView FILE menu. Select open Phylip and find your file. The open command can be problematic on this program. There are several errors that may appear. If the program does not work close it and reopen it and try again. This sometimes clears it. I know that files that would not open once would open later without any changes to the files. This is frustrating, but we have to deal with it. One method I used that seems to work every time is to close all programs down to the desktop level (Word, Internet Explorer, Seaview) then start Seaview and open the carrier1 file.

If the file will not open in Seaview, open it in Word and check the format. PHYLIP format has a line with the number of sequences and a space followed by the number of positions in the alignment. These numbers have to be correct. The sequences start with 10 spaces for names. There have to be ten spaces even if they are empty. Character 11 begins the sequence even if it is with -----. There may be spaces in the alignment (often at every 10 amino acids) and there may be spaces between sets of sequences (equivalent to pages in the alignment). There must not be any extra spaces at the end of lines and the names only appear once on the first page. Below is an example. If you copied the Phylip format output from CLUSTALW and saved it as text only this worked for me.


6 75
89          LPYNLAELQRQQSPG-LGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTR-MQNQ
91          LPFNLAEAQRQKASGDSARPVLLQVAESAYRFGLGSVAGAVGATAVYPIDLVKTR-MQNQ
94          ----------------------------------GGIAGLIGVTCVFPIDLAKTR-LQNQ
95          ----------------------------------GGVAGLVGVTCVFPIDLAKIR-LQN-
132         ------------------------------HMTAGAMAGILEHSVMYPVDSVKTR-MQSL
134         ------------------------------HMVAGAVAGILEHCVMYPIDCVKQTRMQSL

ENMKQTLGVTQK---
ELMKQFFHLN-----
DLMQILLRHLQS---
DSVKVYFRLPRPPPP
DSVKVYFRLPRPPPP


More fun with ClustalW and JalView.

JalView is a Java based sequence editor that comes built into ClustalW as an output viewing option at the site listed above as ClustalW server at EBI with JalView sequence editor

Go get about 4 or 5 human carriers in FASTA format and go to this site. Paste in your sequences and do an alignment so you can see the JalView editor. It is really a cool editor. Once the alignment comes back just click on the JalView button in the gray rectangle. The output has the conservation of amino acids as a histogram plot on the bottom. You can mail the alignment back to yourself from the file menu. This editor allows you to slide a sequence block by clicking and dragging. Try it.

ASSIGNMENT

Do a ClustalW alignment of all the 49 mouse carriers. Save the output in Phylip format and open in SeaView. Sequence 50b has a long N-terminal extension. Delete this extension and then remove all the gap only columns that this creates (a single command does this removal). This will shorten the alignment. Delete sequence 114a since it is very short. There is one place in the alignment where a gap needs to be added to make the alignment look better. Sequences 50B, 51, 52C, 54 and 56 have an extra glycine G at amino acid 94 in seq 51. Use your cursor to find this amino acid. To introduce a gap to improve the alignment, select all the sequences except the five listed above (you will have to scroll down to do this). Introduce a gap between amino acids G66 and F67 of seq 27 (27 is the sequence name not the sequence position in the alignment). Now deselect all the sequences (right click) and select the five listed above. Introduce a gap in front of M80 of seq 51. This should now have G94 of seq 51 aligning with the gap in all sequences except the five with the extra G. Next move the five sequences to the top of the alignment. This should have tested your editing ability. Prepare a printout with block size 50, 80 characters per line and 52 lines per page. Open the printout in word and select the first three pages of the alignment (a page is 48 sequences for this purpose, not a full page length). Save this as a file and send it to me with your name in it somewhere.

References

Needleman S.B and Wunsch C.D. (1970) A general method applicable to the search for similarities in the amino acid sequence of two proteins. J. Mol. Biol. 48, 443-453.

Smith, T.F. and Waterman, M.S. (1981) Identification of common molecular subsequences. J. Mol. Biol. 147, 195-197.

Jeanmougin,F., Thompson,J.D., Gouy,M., Higgins,D.G. and Gibson,T.J. (1998) Multiple sequence alignment with Clustal X. Trends Biochem Sci, 23, 403-5.

Thompson,J.D., Gibson,T.J., Plewniak,F., Jeanmougin,F. and Higgins,D.G. (1997) The ClustalX windows interface: flexible strategies for multiple sequence alignment aided by quality analysis tools. Nucleic Acids Research, 24:4876-4882.

Higgins, D. G., Thompson, J. D. and Gibson, T. J. (1996) Using CLUSTAL for multiple sequence alignments. Methods Enzymol., 266, 383-402.

Thompson, J.D., Higgins, D.G. and Gibson, T.J. (1994) CLUSTAL W: improving the sensitivity of progressive multiple sequence alignment through sequence weighting, positions-specific gap penalties and weight matrix choice. Nucleic Acids Research, 22:4673-4680.

Higgins,D.G., Bleasby,A.J. and Fuchs,R. (1992) CLUSTAL V: improved software for multiple sequence alignment. CABIOS 8,189-191.

Higgins,D.G. and Sharp,P.M. (1989) Fast and sensitive multiple sequence alignments on a microcomputer. CABIOS 5,151-153.

Higgins,D.G. and Sharp,P.M. (1988) CLUSTAL: a package for performing multiple sequence alignment on a microcomputer. Gene 73,237-244.